Antibody data

Product number
HPA054252
Provider
Atlas Antibodies
Product name
Anti-PRKCE
Provider product page
Atlas Antibodies - HPA054252
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNR
GEEHRAASSPDGQLMSPGENGEVRQGQAKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -