HPA023857

CASK antibody from Sigma-Aldrich
CAGH39, FGS4, LIN2, TNRC8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023857
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023857, RRID:AB_1846035
Product name
Anti-CASK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023857
Antibody type
Polyclonal
Antigen
Peripheral plasma membrane protein CASK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKF
NSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIH
ALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTK
SSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKE
Storage
-20C
Provider Type Product Number
- No reagents -