HPA002033

POF1B antibody from Sigma-Aldrich
FLJ22792, POF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002033
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002033, RRID:AB_1079650
Product name
Anti-POF1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002033
Antibody type
Polyclonal
Antigen
Protein POF1B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSETCTGPMLQAKMDEIGNHYTEMVKNLRMEKDRE
ICRLRSQLNQYHKDVSKREGSCSDFQFKLHELTSL
LEEKDSLIKRQSEELSKLRQEIYSSHNQPSTGGRT
TITTKKYRTQYPILGLLYDDYEYIPPGSETQTI
Storage
-20C
Provider Type Product Number
- No reagents -