HPA021939

CFTR antibody from Atlas Antibodies
ABC35, ABCC7, CF, CFTR/MRP, dJ760C5.1, MRP7, TNR-CFTR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021939
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021939, RRID:AB_1846578
Product name
Anti-CFTR
Provider product page
Atlas Antibodies - HPA021939
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLV
PDSEQGEAILPRISVISTGPTLQARRRQSVLNLMT
HSVNQGQNIHRKTTASTRKVSLAPQANLTELDIYS
RRLSQETGLEISEEINEEDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -