HPA020896

ASS1 antibody from Sigma-Aldrich
ASS, CTLN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020896, RRID:AB_1845117
Product name
Anti-ASS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020896
Antibody type
Polyclonal
Antigen
Argininosuccinate synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYL
ANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVE
EFIWPAIQS
Storage
-20C
Provider Type Product Number
- No reagents -