HPA054241

RCOR1 antibody from Atlas Antibodies
COREST, KIAA0071, RCOR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA054241
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA054241, RRID:AB_2682426
Product name
Anti-RCOR1
Provider product page
Atlas Antibodies - HPA054241
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQE
RDNLGMLV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -