PAB29456

RCOR1 antibody from Abnova Corporation
COREST, KIAA0071, RCOR

Antibody data

Product number
PAB29456
Provider
Abnova Corporation
Product name
RCOR1 polyclonal antibody
Provider product page
Abnova Corporation - PAB29456
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human RCOR1.
Antigen sequence
SSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQE
RDNLGMLV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -