HPA049327

RCOR1 antibody from Atlas Antibodies
COREST, KIAA0071, RCOR

Antibody data

Product number
HPA049327
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049327, RRID:AB_2680715
Product name
Anti-RCOR1
Provider product page
Atlas Antibodies - HPA049327
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEED
EAPVLDVRYASAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -