AV39179

RCOR1 antibody from MilliporeSigma / Merck KGaA
COREST, KIAA0071, RCOR
No application information provided.

Antibody data

Product number
AV39179
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV39179, RRID:AB_1856156
Product name
Anti-RCOR1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV39179
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human RCOR1 with an internal ID of P21284
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPE
EEDEAPVLDVRYASA
Storage
-20C
Provider Type Product Number
- No reagents -