HPA020076

SAFB antibody from Sigma-Aldrich
HET, SAFB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020076
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020076, RRID:AB_1850624
Product name
Anti-SAFB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020076
Antibody type
Polyclonal
Antigen
Scaffold attachment factor B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSV
ADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQ
EHAIEDKETINNLDTSSSDFTILQ
Storage
-20C
Provider Type Product Number
- No reagents -