Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 73-314 - Provider product page

- Provider
- UC Davis/NIH NeuroMab Facility
- Proper citation
- UC Davis/NIH NeuroMab Facility Cat#73-314, RRID:AB_2315858
- Product name
- anti-Kv1.2 potassium channel
- Antibody type
- Monoclonal
- Antigen
- Recombinant protein
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
amino acids 428-499 (QYLQVTSCPKIPSS
PDLKKSRSASTISKSDYMEIQEGVNNSNEDFREEN
LKTANCTLANTNYVNITKMLTDV, cytoplasmi
c C-terminus) of human Kv1.2- Isotype
- IgG
- Antibody clone number
- L76/36
- Vial size
- 5000 µl
- Concentration
- TC Supe
- Storage
- Antibodies contain 10mm azide. Store at 4°C or aliquot and store at -20°C. Avoid repeated free-thaw cycles.
Submitted references Benefits and pitfalls of secondary antibodies: why choosing the right secondary is of primary importance.
Manning CF, Bundros AM, Trimmer JS
PloS one 2012;7(6):e38313
PloS one 2012;7(6):e38313
No comments: Submit comment
No validations: Submit validation data