HPA001880

PQBP1 antibody from Sigma-Aldrich
MRX2, MRX55, MRXS8, RENS1, SHS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001880
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001880, RRID:AB_1079671
Product name
Anti-PQBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001880
Antibody type
Polyclonal
Antigen
Polyglutamine-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPV
DYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLV
SWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHD
KSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRE
RGYDKVD
Storage
-20C
Provider Type Product Number
- No reagents -