HPA045866

CMC4 antibody from Atlas Antibodies
MTCP1, MTCP1NB, p8, P8MTCP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045866
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045866, RRID:AB_10964642
Product name
Anti-CMC4
Provider product page
Atlas Antibodies - HPA045866
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQEL
RKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -