HPA028138

VAV3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028138
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028138, RRID:AB_10603141
Product name
Anti-VAV3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028138
Antibody type
Polyclonal
Antigen
vav 3 guanine nucleotide exchange factor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVD
YSCQPWYAGAMERLQAETELINRVNSTYLVRHRTK
ESGEYAI
Storage
-20C
Provider Type Product Number
- No reagents -