PAB20132

DIPK2B antibody from Abnova Corporation
CXorf36, DIA1R, FLJ14103

Antibody data

Product number
PAB20132
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20132, RRID:AB_10965595
Product name
CXorf36 polyclonal antibody
Provider product page
Abnova Corporation - PAB20132
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CXorf36.
Antigen sequence
SLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIG
TSICKKFFKEEIRSDNWLASHLGLPPDSLLSYPAN
YSDDSKIWRPVEIFRLVSKYQNEISDRRICASASA
PKTCSIERVLRKTERFQKWLQAKRLTPDL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -