HPA001502

CNKSR2 antibody from Sigma-Aldrich
CNK2, KIAA0902, KSR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001502
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001502, RRID:AB_1078542
Product name
Anti-CNKSR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001502
Antibody type
Polyclonal
Antigen
Connector enhancer of kinase suppressor of ras 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLQDLYRALEQASLSPLGEHRISTKMEYKLSFIKR
CNDPVMNEKLHRLRILKSTLKAREGEVAIIDKVLD
NPDLTSKEFQQWKQMYLDLFLDICQNTTSNDPLSI
SSEVDVITSSLAHTHSYIET
Storage
-20C
Provider Type Product Number
- No reagents -