Antibody data

Product number
H00006286-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006286-M02, RRID:AB_1137020
Product name
S100P monoclonal antibody (M02), clone 4E7
Provider product page
Abnova Corporation - H00006286-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant S100P.
Antigen sequence
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKV
LMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVD
FSEFIVFVAAITSACHKYFEKAGLK
Isotype
IgG
Antibody clone number
4E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -