PAB27502
antibody from Abnova Corporation
Targeting: SHLD2
bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27502 - Provider product page
- Provider
- Abnova Corporation
- Product name
- FAM35A polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant FAM35A.
- Antigen sequence
FLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSR
LSDITSSNMQICGFKSTVPHFTEEEKYQKLLSENK
IRDEQPKHQPD- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with FAM35A polyclonal antibody (Cat # PAB27502) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with FAM35A polyclonal antibody (Cat # PAB27502) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and cytoskeleton (actin filaments).
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder with with FAM35A polyclonal antibody (Cat # PAB27502) shows strong cytoplasmic positivity in urothelial cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)