H00002664-M08

GDI1 antibody from Abnova Corporation
FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4

Antibody data

Product number
H00002664-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002664-M08, RRID:AB_518829
Product name
GDI1 monoclonal antibody (M08), clone 1H3
Provider product page
Abnova Corporation - H00002664-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant GDI1.
Antigen sequence
MDEEYDVIVLGTGLTECIPSGIMSVNGKKVLHMDR
NPYYGGESSSITPLEELYKRFQLLEGPPESMGRGR
DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVV
EGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRF
RKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKF
DLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIK
LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIY
GGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQL
ICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDAN
SCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYI
AIASTTVETTDPEKEVEPALELLGPIDQKFVAISD
LYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGTAFDFENMKRKQNDVFGEAEQ
Isotype
IgG
Antibody clone number
1H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -