AV13086

GDI1 antibody from MilliporeSigma / Merck KGaA
FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
No application information provided.

Antibody data

Product number
AV13086
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV13086, RRID:AB_1849597
Product name
Anti-GDI1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV13086
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human GDI1 with an internal ID of P01411
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFE
NMKRKQNDVFGEAEQ
Storage
-20C
Provider Type Product Number
- No reagents -