Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000212-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000212-M01, RRID:AB_529954
- Product name
- ALAS2 monoclonal antibody (M01), clone 6C1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALAS2.
- Antigen sequence
MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGI
GRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHC
PFMLSELQDGKSKIVQKAAPEVQEDVKAFK- Isotype
- IgG
- Antibody clone number
- 6C1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Emodin can induce K562 cells to erythroid differentiation and improve the expression of globin genes.
Hypoxic induction of human erythroid-specific δ-aminolevulinate synthase mediated by hypoxia-inducible factor 1.
Ma YN, Chen MT, Wu ZK, Zhao HL, Yu HC, Yu J, Zhang JW
Molecular and cellular biochemistry 2013 Oct;382(1-2):127-36
Molecular and cellular biochemistry 2013 Oct;382(1-2):127-36
Hypoxic induction of human erythroid-specific δ-aminolevulinate synthase mediated by hypoxia-inducible factor 1.
Zhang FL, Shen GM, Liu XL, Wang F, Zhao HL, Yu J, Zhang JW
Biochemistry 2011 Feb 22;50(7):1194-202
Biochemistry 2011 Feb 22;50(7):1194-202
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALAS2 monoclonal antibody (M01), clone 6C1. Western Blot analysis of ALAS2 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ALAS2 expression in transfected 293T cell line by ALAS2 monoclonal antibody (M01), clone 6C1.Lane 1: ALAS2 transfected lysate(64 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ALAS2 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol