Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502186 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aminolevulinate, delta-, Synthase 2 (ALAS2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVI
PCPSH IIPIRVGNAA- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Non-genomic immunosuppressive actions of progesterone inhibits PHA-induced alkalinization and activation in T cells.
Three kinships with ALAS2 P520L (c. 1559 C --> T) mutation, two in association with severe iron overload, and one with sideroblastic anemia and severe iron overload.
Chien EJ, Chang CP, Lee WF, Su TH, Wu CH
Journal of cellular biochemistry 2006 Sep 1;99(1):292-304
Journal of cellular biochemistry 2006 Sep 1;99(1):292-304
Three kinships with ALAS2 P520L (c. 1559 C --> T) mutation, two in association with severe iron overload, and one with sideroblastic anemia and severe iron overload.
Lee PL, Barton JC, Rao SV, Acton RT, Adler BK, Beutler E
Blood cells, molecules & diseases 2006 Mar-Apr;36(2):292-7
Blood cells, molecules & diseases 2006 Mar-Apr;36(2):292-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
