HPA001638

ALAS2 antibody from Sigma-Aldrich
ASB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001638
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001638, RRID:AB_1078124
Product name
Anti-ALAS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001638
Antibody type
Polyclonal
Antigen
5-Aminolevulinate synthase, erythroid-specific, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWAD
AYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQV
LQATQETLQRHGAGAGGTRNISGTSKFHVELEQEL
AELHQKDSALLFSSCFVANDSTLFTLAKILPGCEI
YSDAGNHAS
Storage
-20C
Provider Type Product Number
- No reagents -