Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011187-M04 - Provider product page
- Provider
- Abnova Corporation
- Product name
- PKP3 monoclonal antibody (M04), clone 6E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PKP3.
- Antigen sequence
RAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHR
SRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHL
PDVHGFNSYGSHRTLQRLSSGFDDIDLPSA- Isotype
- IgG
- Antibody clone number
- 6E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PKP3 expression in transfected 293T cell line by PKP3 monoclonal antibody (M04), clone 6E5.Lane 1: PKP3 transfected lysate (Predicted MW: 87.67 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PKP3 monoclonal antibody (M04), clone 6E5. Western Blot analysis of PKP3 expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PKP3 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol