HPA001608

TLR8 antibody from Sigma-Aldrich
CD288
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001608
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001608, RRID:AB_1080295
Product name
Anti-TLR8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001608
Antibody type
Polyclonal
Antigen
Toll-like receptor 8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVT
ELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQ
HQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQ
LPQIPSGLPESLTELSL
Storage
-20C
Provider Type Product Number
- No reagents -