HPA014703

CLDN7 antibody from Sigma-Aldrich
CEPTRL2, CPETRL2, Hs.84359
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014703
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014703, RRID:AB_1846873
Product name
Anti-CLDN7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014703
Antibody type
Polyclonal
Antigen
Claudin-7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMM
SCKMYDSVLALS
Storage
-20C
Provider Type Product Number
- No reagents -