H00001009-M30

CDH11 antibody from Abnova Corporation
CAD11, OB
No application information provided.

Antibody data

Product number
H00001009-M30
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001009-M30, RRID:AB_11189699
Product name
CDH11 monoclonal antibody (M30), clone 2C79
Provider product page
Abnova Corporation - H00001009-M30
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDH11.
Antigen sequence
GWVWNQFFVIEEYTGPDPVLVGRLHSDIDSGDGNI
KYILSGEGAGTIFVIDDKSGNIHATKTLDREERAQ
YTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPE
FLHETYHANVPERSNVGTSVIQVTASDADDPTYGN
SAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREA
KEEYHVVIQAKDMGGHMGGLSGTTKVMITLTDVND
NPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIG
ENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKK
PVDFETKRAYSLKVEAANVHIDPKFISNGPFKDTV
TVKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVG
RVHAKDPDAANSPIRYSIDRHTDLDRFFTINPEDG
FIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVP
VAIRVLDVNDNAPKFAAPYEGFICESDQTKPLSNQ
PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTV
RDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGG
IPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILN
Isotype
IgG
Antibody clone number
2C79
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -