Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001009-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001009-M01, RRID:AB_606046
- Product name
- CDH11 monoclonal antibody (M01), clone 4D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDH11.
- Antigen sequence
PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTV
RDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGG
IPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNA
GLST- Isotype
- IgG
- Antibody clone number
- 4D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Development of a surface plasmon resonance biosensor for real-time detection of osteogenic differentiation in live mesenchymal stem cells.
Kuo YC, Ho JH, Yen TJ, Chen HF, Lee OK
PloS one 2011;6(7):e22382
PloS one 2011;6(7):e22382
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CDH11 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol