Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183371 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Gap Junction Protein, beta 2, 26kDa (GJB2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIE
EIKTQ KVRIEGSLWW- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression of connexin 26 in the ganglionic eminence of preterm infants after bleedings.
Ulfig N
Neuroscience research 2004 Sep;50(1):125-8
Neuroscience research 2004 Sep;50(1):125-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- WB Suggested Anti-GJB2 Antibody Positive Control: Lane 1:41 μg mCx26 elution fraction 6 Lane 2: uug mCx26 elution fraction 7Lane 3: uug mCx26 elution fraction 6 + other Cx26 Antibody Lane 4: uug mCx26 elution fraction 7 + other Cx26 Antibody Primary Antibody Dilution: 1: u000Secondary Antibody: Anti-rabbit-HRP Secondry Antibody Dilution: 1: u000Submitted by: Juan Zou, Georgia state unviersity