Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038630 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-NLRX1
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
ELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLEL
LLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQL
GSSGS- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references NLRX1 dampens oxidative stress and apoptosis in tissue injury via control of mitochondrial activity
Stokman G, Kors L, Bakker P, Rampanelli E, Claessen N, Teske G, Butter L, van Andel H, van den Bergh Weerman M, Larsen P, Dessing M, Zuurbier C, Girardin S, Florquin S, Leemans J
Journal of Experimental Medicine 2017;214(8):2405-2420
Journal of Experimental Medicine 2017;214(8):2405-2420
No comments: Submit comment
No validations: Submit validation data