HPA061260

HPS1 antibody from Atlas Antibodies
BLOC3S1, HPS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA061260
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061260, RRID:AB_2684459
Product name
Anti-HPS1
Provider product page
Atlas Antibodies - HPA061260
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKK
LKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQE
IQSTWLEFKAKAFSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -