PAB28454
antibody from Abnova Corporation
		Targeting: RBM39
		
		CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunocytochemistry [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - PAB28454 - Provider product page

 - Provider
 - Abnova Corporation
 - Product name
 - RBM39 polyclonal antibody
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against recombinant RBM39.
 - Antigen sequence
 LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEI
KDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSI
AAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFP
DSMTATQ- Isotype
 - IgG
 - Storage
 - Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western blot analysis of Lane 1: RT-4, Lane 2: EFO-21, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with RBM39 polyclonal antibody (Cat # PAB28454) at 1:100-1:250 dilution.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunofluorescent staining of U-2 OS with RBM39 polyclonal antibody (Cat # PAB28454) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules).
 - Validation comment
 - Immunofluorescence
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunohistochemical staining of human colon with RBM39 polyclonal antibody (Cat # PAB28454) shows nuclear positivity in glandular cells at 1:50-1:200 dilution.
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)