H00009584-M01
antibody from Abnova Corporation
Targeting: RBM39
CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009584-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009584-M01, RRID:AB_566141
- Product name
- RNPC2 monoclonal antibody (M01), clone 4G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNPC2.
- Antigen sequence
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKH
GGVIHIYVDKNSAQG- Isotype
- IgG
- Antibody clone number
- 4G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RNPC2 monoclonal antibody (M01), clone 4G8 Western Blot analysis of RNPC2 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RNPC2 monoclonal antibody (M01), clone 4G8. Western Blot analysis of RNPC2 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody (M01), clone 4G8.Lane 1: RBM39 transfected lysate(58.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RNPC2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RNPC2 on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol