HPA001591

RBM39 antibody from Atlas Antibodies
CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA001591
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001591, RRID:AB_611756
Product name
Anti-RBM39
Provider product page
Atlas Antibodies - HPA001591
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEI
KDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSI
AAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFP
DSMTATQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -