HPA001591

RBM39 antibody from Sigma-Aldrich
CAPER, CAPERalpha, CC1.3, fSAP59, HCC1, RNPC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001591
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001591, RRID:AB_1079749
Product name
Anti-RBM39 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001591
Antibody type
Polyclonal
Antigen
RNA-binding protein 39 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEI
KDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSI
AAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFP
DSMTATQ
Storage
-20C
Provider Type Product Number
- No reagents -