HPA000866

SYNJ2BP antibody from Atlas Antibodies
Arip2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA000866
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA000866, RRID:AB_2276678
Product name
Anti-SYNJ2BP
Provider product page
Atlas Antibodies - HPA000866
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYV
SNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQ
DLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGP
IGHRGEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -