SAB1400613

SYNJ2BP antibody from Sigma-Aldrich
Arip2
ELISA
Recommended by provider

Antibody data

Product number
SAB1400613
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400613, RRID:AB_1857695
Product name
Anti-SYNJ2BP antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400613
Antibody type
Polyclonal
Antigen
SYNJ2BP (AAH07704, a.a. 1-145) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQY
VSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG
QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNG
PIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR
YRQQL (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -