Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501538 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RAD54-Like (S. Cerevisiae) (RAD54L) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RAD54L antibody: synthetic peptide directed towards the N terminal of human RAD54L
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDE
IDQKL EGFMNQRGAR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Comprehensive analysis of DNA repair gene variants and risk of meningioma.
Bethke L, Murray A, Webb E, Schoemaker M, Muir K, McKinney P, Hepworth S, Dimitropoulou P, Lophatananon A, Feychting M, Lönn S, Ahlbom A, Malmer B, Henriksson R, Auvinen A, Kiuru A, Salminen T, Johansen C, Christensen HC, Kosteljanetz M, Swerdlow A, Houlston R
Journal of the National Cancer Institute 2008 Feb 20;100(4):270-6
Journal of the National Cancer Institute 2008 Feb 20;100(4):270-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting