HPA001906

ATRX antibody from Atlas Antibodies
JMS, MRX52, RAD54, XH2, XNP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001906
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001906, RRID:AB_1078249
Product name
Anti-ATRX
Provider product page
Atlas Antibodies - HPA001906
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTP
YIPFNLGALSAMSNQQLEDLINQGREKVVEATNSV
TAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQ
ASQELDVKRREAIYNDVLTKQQMLISCVQRILMNR
R
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -