HPA001906

ATRX antibody from Sigma-Aldrich
JMS, MRX52, RAD54, XH2, XNP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001906
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001906, RRID:AB_1078249
Product name
Anti-ATRX antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001906
Antibody type
Polyclonal
Antigen
ATRX_HUMAN Isoform 5 of P46100 - Homo sapiens recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTP
YIPFNLGALSAMSNQQLEDLINQGREKVVEATNSV
TAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQ
ASQELDVKRREAIYNDVLTKQQMLISCVQRILMNR
R
Storage
-20C
Provider Type Product Number
- No reagents -