HPA021012

ATIC antibody from Sigma-Aldrich
AICARFT, IMPCHASE, PURH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021012
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021012, RRID:AB_1845169
Product name
Anti-ATIC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021012
Antibody type
Polyclonal
Antigen
Bifunctional purine biosynthesis protein PURH recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVT
GTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKL
TEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSA
ADKVVIEACDELGIILAH
Storage
-20C
Provider Type Product Number
- No reagents -