WH0003656M1

IRAK2 antibody from Sigma-Aldrich
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0003656M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0003656M1, RRID:AB_1842139
Product name
Monoclonal Anti-IRAK2 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0003656M1
Antibody type
Monoclonal
Antigen
IRAK2 (NP_001561, a.a. 111-210) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSP
ARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDF (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -