Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA044204 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA044204, RRID:AB_10959383
- Product name
- Anti-NEURL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRV
FHRINDSAVMLFFSGVRTADPLWALVD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Conjunctival melanoma copy number alterations and correlation with mutation status, tumor features, and clinical outcome.
Kenawy N, Kalirai H, Sacco JJ, Lake SL, Heegaard S, Larsen AC, Finger PT, Milman T, Chin K, Mosci C, Lanza F, Moulin A, Schmitt CA, Caujolle JP, Maschi C, Marinkovic M, Taktak AF, Heimann H, Damato BE, Coupland SE
Pigment cell & melanoma research 2019 Jul;32(4):564-575
Pigment cell & melanoma research 2019 Jul;32(4):564-575
No comments: Submit comment
No validations: Submit validation data