HPA023420

TRIM5 antibody from Atlas Antibodies
RNF88, TRIM5alpha
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023420
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023420, RRID:AB_1856378
Product name
Anti-TRIM5
Provider product page
Atlas Antibodies - HPA023420
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KGMLEVFRELTDVRRYWVDVTVAPNNISCAVISED
KRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGS
QS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -