HPA023420

TRIM5 antibody from Sigma-Aldrich
RNF88, TRIM5alpha
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023420
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023420, RRID:AB_1856378
Product name
Anti-TRIM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023420
Antibody type
Polyclonal
Antigen
Tripartite motif-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGMLEVFRELTDVRRYWVDVTVAPNNISCAVISED
KRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGS
QS
Storage
-20C
Provider Type Product Number
- No reagents -