HPA003614

HAUS7 antibody from Sigma-Aldrich
UCHL5IP, UIP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003614
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003614, RRID:AB_1080368
Product name
Anti-UCHL5IP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003614
Antibody type
Polyclonal
Antigen
UCHL5-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVE
VFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYR
LEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMT
KLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLD
TIRSL
Storage
-20C
Provider Type Product Number
- No reagents -