HPA040082

SPATA19 antibody from Atlas Antibodies
CT132, FLJ25851, SPAS1, spergen1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040082
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040082, RRID:AB_2676836
Product name
Anti-SPATA19
Provider product page
Atlas Antibodies - HPA040082
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KHHLSKSDLLANQSQEVLEERTRIQFIRWSHTRIF
QVPSEMTEDIMRDRIEQVRRSISRLTDVSAQDFSM
RPSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -