HPA020255

MPDZ antibody from Atlas Antibodies
MUPP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020255
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020255, RRID:AB_1854073
Product name
Anti-MPDZ
Provider product page
Atlas Antibodies - HPA020255
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLC
DIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQST
EEVQAPLAMWEAGIQHIELEKGSKGLGFS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -