HPA026686

MPDZ antibody from Sigma-Aldrich
MUPP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026686
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026686, RRID:AB_1854074
Product name
Anti-MPDZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026686
Antibody type
Polyclonal
Antigen
Multiple PDZ domain protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MIVRSIIHGGAISRDGRIAIGDCILSINEESTISV
TNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKIS
LGQQSGRVMALDIFSSYTGRDIPELPEREE
Storage
-20C
Provider Type Product Number
- No reagents -