HPA051377

NDUFB2 antibody from Atlas Antibodies
AGGG, CI-AGGG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA051377
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051377, RRID:AB_2681460
Product name
Anti-NDUFB2
Provider product page
Atlas Antibodies - HPA051377
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPD
PSQWTDEELGIPPDDED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -